missing translation for 'onlineSavingsMsg'
Learn More

receptor-interacting serine-threonine kinase 4, Mouse, Clone: 1G2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RIPK4.

Brand: Abnova H00054101-M02.100ug

Product Code. 16127476

349.00 € / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq

Sequence: HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

Specifications

Antigen	receptor-interacting serine-threonine kinase 4
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_020639
Gene Symbols	RIPK4
Immunogen	RIPK4 (NP_065690, 675 a.a. ∼ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Kinases
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Western Blot
Clone	1G2
Description	Mouse monoclonal antibody raised against a partial recombinant RIPK4.
Gene	RIPK4
Gene Alias	ANKK2/ANKRD3/DIK/MGC129992/MGC129993/PKK/RIP4
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	54101
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

receptor-interacting serine-threonine kinase 4, Mouse, Clone: 1G2, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions