missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
393.00 € - 598.00 €
Specifications
| Accession Number | AAB37352 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Source | Wheat Germ (in vitro) |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16141044
|
Abnova™
P0001.10ug |
10 μg |
393.00 €
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16151044
|
Abnova™
P0001.25ug |
25 μg |
598.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Specifications
| AAB37352 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
| Wheat Germ (in vitro) | |
| MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C Aliquot to avoid repeated freezing and thawing | |
| Human |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ GST Protein