Learn More
Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104388
176.67 EUR valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Specifications
P0DUB6 | |
Blocking Assay, Control | |
276 | |
100 μL | |
1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase | |
AMY1A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human alpha Amylase 1 (aa 242-300) Control Fragment | |
RUO | |
alpha Amylase 1 | |
Unconjugated | |
Recombinant | |
KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.