missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ATR (aa 1392-1475) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP106526
This item is not returnable.
View return policy
Description
The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.
Specifications
| Q13535 | |
| Blocking Assay, Control | |
| 545 | |
| 100 μL | |
| RUO | |
| ATR | |
| Human | |
| FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| ATR | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 2310008J16Rik; 2810405N18Rik; ataxia telangiectasia and Rad3 related; ataxia telangiectasia and Rad3-related protein; ATR; ATR serine/threonine kinase; EC 2.7.11.1; FCTCS; FRAP-related protein 1; FRAP-related protein-1; FRP1; I79_000761; kinase ATR; MEC1; MEC1, mitosis entry checkpoint 1, homolog; protein kinase ATR; SCKL; SCKL1; Serine/threonine-protein kinase ATR; TEM8 | |
| Unconjugated | |
| Recombinant | |
| E. coli |