missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102000
176.67 EUR valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52211 (PA5-52211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARMT1 gene ontology annotations related to this gene include protein carboxyl O-methyltransferase activity.
Specifications
| Q9H993 | |
| Blocking Assay, Control | |
| 79624 | |
| 100 μL | |
| Acidic residue methyltransferase 1; ARMT1; C6orf211; Damage-control phosphatase ARMT1; Protein-glutamate O-methyltransferase; Sugar phosphate phosphatase ARMT1; UPF0364 protein C6orf211 | |
| ARMT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C6orf211 (aa 259-378) Control Fragment | |
| RUO | |
| C6orf211 | |
| Unconjugated | |
| Recombinant | |
| LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction