missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase III (aa 190-260) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP92483
This item is not returnable.
View return policy
Description
Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10. 3 kb and contains seven exons and six introns.Specifications
P07451 | |
Blocking Assay, Control | |
1M urea, PBS with no preservative; pH 7.4 | |
Carbonic Anhydrase III | |
-20° C, Avoid Freeze/Thaw Cycles | |
BB219044; CA III; Ca3; CAH3; CAIII; CA-III; CAIII (Muscle); Car3; Car-3; Carbonate dehydratase III; carbonic anhydrase 3; Carbonic anhydrase III; carbonic anhydrase III, muscle specific; carbonic anhydrase-like protein; EC 4.2.1.1; epididymis secretory sperm binding protein Li 167mP; HEL-S-167mP | |
Unconjugated | |
YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK |
≥5.0 mg/mL | |
Liquid | |
761 | |
100 μL | |
RUO | |
Ca3 | |
Recombinant | |
E. coli |