missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase VI (aa 119-215) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94191
This item is not returnable.
View return policy
Description
The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.Specifications
P23280 | |
Blocking Assay, Control | |
1M urea, PBS with no preservative; pH 7.4 | |
Carbonic Anhydrase VI | |
-20° C, Avoid Freeze/Thaw Cycles | |
CA6; CA-6; Car6; Carbonate dehydratase VI; carbonic anhydrase 6; Carbonic anhydrase VI; carbonic anhydrase VI nirs variant 2; Carbonic anhydrase6; CA-VI; DOC1; GUSTIN; salivary carbonic anhydrase; Secreted carbonic anhydrase | |
Unconjugated | |
SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY |
≥5.0 mg/mL | |
Liquid | |
765 | |
100 μL | |
RUO | |
CA6 | |
Recombinant | |
E. coli |