missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase X (aa 275-328) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP106797
This item is not returnable.
View return policy
Description
This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene.Specifications
Q9NS85 | |
Blocking Assay, Control | |
1M urea, PBS with no preservative; pH 7.4 | |
Carbonic Anhydrase X | |
-20° C, Avoid Freeze/Thaw Cycles | |
2700029L05Rik; BB085816; Ca10; Car10; carbonic anhydrase 10; carbonic anhydrase X; carbonic anhydrase-related protein 10; Carbonic anhydrase-related protein X; CARP X; CA-RP X; CARPX; CA-RPX; Cerebral protein 15; cerebral protein-15; HUCEP-15; UNQ533/PRO1076 | |
Unconjugated | |
PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
≥5.0 mg/mL | |
Liquid | |
56934 | |
100 μL | |
RUO | |
CA10 | |
Recombinant | |
E. coli |