missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase XII (aa 159-278) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP89981

Product Code. 30196979

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Carbonic Anhydrase XII is a protein coding gene.

Specifications

Accession Number	O43570
For Use With (Application)	Blocking Assay, Control
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	Carbonic Anhydrase XII
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	2310047E01Rik; AI314958; CA12; Car12; Carbonate dehydratase XII; carbonic anhydrase 12; Carbonic anhydrase XII; carbonic anyhydrase 12; carbonic dehydratase; CAXII; CA-XII; HsT18816; membrane-bound carbonic anhydrase 12; T18816; tumor antigen HOM-RCC-3.1.3
Conjugate	Unconjugated
Sequence	TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ

Product Suggestions

Description