missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase XIV (aa 19-163) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90144
This item is not returnable.
View return policy
Description
CA14 belongs a large family of zinc metalloenzymes that catalyze the versible hydration of carbon dioxide. The protein is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles.
Specifications
| Q9ULX7 | |
| Blocking Assay, Control | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Carbonic Anhydrase XIV | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| AW536446; CA XIV; CA14; Car14; Carbonate dehydratase XIV; carbonic anhydrase 14; Carbonic anhydrase XIV; carbonic dehydratase; Catm; CAXiV; CA-XIV; UNQ690/PRO1335 | |
| Unconjugated | |
| GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGIL |
| ≥5.0 mg/mL | |
| Liquid | |
| 23632 | |
| 100 μL | |
| RUO | |
| CA14 | |
| Recombinant | |
| E. coli |