missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DAAM2 Full-length ORF (AAH47575.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Specifications
Accession Number | AAH47575.1 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 23500 |
Molecular Weight (g/mol) | 41.3kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16147382
|
Abnova™
H00023500-P01.25ug |
25 ug |
508.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
16137382
|
Abnova™
H00023500-P01.10ug |
10 ug |
335.00 €
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sequence: MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSESpecifications
AAH47575.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
41.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE | |
RUO | |
DAAM2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
23500 | |
DAAM2 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KIAA0381/MGC90515/dJ90A20A.1 | |
DAAM2 | |
Recombinant | |
wheat germ expression system |