missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FNDC1 (aa 866-946) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP94940

Product Code. 30206113

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Specifications

Accession Number	Q4ZHG4
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	84624
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	FNDC1
Species	Human
Sequence	DSHPKLSSGIHGDEEDEKPLPATVVNDHVPSSSRQPISRGWEDLRRSPQRGASLHRKEPIPENPKSTGADTHPQGKYSSLA
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	FNDC1
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	1110027O12Rik; 1110051A18Rik; Activation-associated cDNA protein; activator of G-protein signaling 8; AGS8; bA243O10.1; dJ322A24.1; expressed in synovial lining protein; fibronectin type III domain containing 1; fibronectin type III domain containing 2; fibronectin type III domain-containing protein 1; FNDC1; FNDC2; KIAA1866; MEL4B3; mKIAA1866
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description