missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human METTL2 Partial ORF (NP_060866.1, 41 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00055798-Q01.10ug
This item is not returnable.
View return policy
Description
This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]
Sequence: SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICADSpecifications
NP_060866.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.22kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD | |
RUO | |
METTL2B | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
55798 | |
METTL2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ11350/FLJ12760/METL/METTL2/METTL2A/PSENIP1 | |
METTL2B | |
Recombinant | |
wheat germ expression system |