missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NCoR1 (aa 2076-2170) Control Fragment Recombinant Protein

Product Code. 30206155
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206155

Brand: Invitrogen™ RP101322

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75376
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9611
Name Human NCoR1 (aa 2076-2170) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730405M06Rik; A230020K14Rik; h KIAA1047; hCIT529I10; hN-CoR; KIAA1047; MGC104216; mKIAA1047; NCoR; N-CoR; N-Cor/SMRT corepressor Rip13; N-Cor/SMRT corepressor, Rip13; NCOR1; N-CoR1; nuclear receptor corepressor; nuclear receptor corepressor 1; nuclear receptor co-repressor 1; PPP1R109; protein phosphatase 1, regulatory subunit 109; retinoid x receptor interacting protein 13; retinoid x receptor-interacting protein 13; RIP13; Rxrip13; thyroid hormone- and retinoic acid receptor-associated corepressor 1; TRAC1
Common Name NCoR1
Gene Symbol Ncor1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.