missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human S100A10 (aa 1-67) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102006
176.67 EUR valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82082 (PA5-82082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The S-100 family of calcium-activated proteins interact with a range of target proteins to modulate biological signaling pathways. Numerous cancer cell lines overexpress the plasminogen receptor S-100A10 on the extracellular cell surface, where it forms a heterotetrameric complex with Annexin II, though this association is not required for plasma membrane localization or binding and activation of plasminogen. Additionally, S-100A10 acts as a cellular chaperone for hepatitis B (Hep B) virus polymerase. Hep B virus polymerase normally localizes to the cytoplasm only, though in the presence of S-100A10 a portion relocates to the nucleus, implying a role for S-100A10 and intracellular calcium in the process of viral replication.
Specifications
| P60903 | |
| Blocking Assay, Control | |
| 6281 | |
| 100 μL | |
| 42 C; AA409961; AL024248; Annexin II; annexin II ligand; annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; AN x 2 L; AN x 2 LG; Ca[1 ]; CAL12; Cal1l; calcium binding protein A11 (calgizzarin); calpactin I light chain; Calpactin-1 light chain; cellular ligand of annexin II; CLP11; GP11; MGC111133; MGC133268; Nerve growth factor-induced protein 42 C; OTTHUMP00000015270; P PRSS26; p10; p10 protein; P11; p11 subunit; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calgizzarin); S100 calcium binding protein A10 (calpactin); S100 calcium-binding protein A10; S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S-100 related protein, clone 42 C; S100a10 | |
| S100A10 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human S100A10 (aa 1-67) Control Fragment | |
| RUO | |
| S100A10 | |
| Unconjugated | |
| Recombinant | |
| MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human S100A10 (aa 1-67) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction