missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Methionine Sulfoxide Reductase B Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-57316PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase B. Source: E.coli Amino Acid Sequence: PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH The Methionine Sulfoxide Reductase B Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 51734 | |
| Methionine Sulfoxide Reductase B Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SelX | |
| Unlabeled | |
| 100μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| MSRB1 | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53162. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only.