missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NRG4 Recombinant Protein
Human NRG4 full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00145957-P01-10
This item is not returnable.
View return policy
Description
The neuregulins, including NRG4, activate type-1 growth factor receptors to initiating cell-to-cell signaling through tyrosine phosphorylation
- Theoretical MW (kDa): 38.39
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH17568 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
38.39 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH | |
DKFZp779N0541/DKFZp779N1944/HRG4 | |
NRG4 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
145957 | |
NRG4 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NRG4 | |
Human | |
Recombinant | |
Solution |