missing translation for 'onlineSavingsMsg'
Learn More

PKC epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-21224-25ul

View more versions of this product

Product Code. 18665214

378.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PKC epsilon Polyclonal antibody specifically detects PKC epsilon in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	PKC epsilon
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	EC 2.7.11, EC 2.7.11.13, MGC125656, nPKC-epsilon, PKCEMGC125657, protein kinase C epsilon type, protein kinase C, epsilon
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLG
Quantity	25 μg
Research Discipline	Apoptosis, Cancer, Phospho Specific, Signal Transduction
Gene ID (Entrez)	5581
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 12

Catalog No. 10399053

Invitrogen ™ Countess ™ Cell Counting Chamber Invitrogen ™ Countess ™ Cell Counting Chamber

141,00 € / Pack of 50
Catalog No. 10125092

Invitrogen ™ Phalloidin Labeling Probes Invitrogen ™ Phalloidin Labeling Probes

922,00 € / 300 units
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

11.405,00 € / Each
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

345,00 € / Each
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100µL

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

PKC epsilon Antibody, Novus Biologicals™ > 25 μg; Unconjugated

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

PKC epsilon Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Sonderangebote

You recently viewed...Show