missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SPDEF Recombinant Protein

Brand: Abnova™ H00025803-P01.10ug

Product Code. 16127762

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH21299
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	62.59
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Gene Alias	PDEF/RP11-375E1__A.3/bA375E1.3
Gene Symbol	SPDEF
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	25803
Name	SPDEF (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SPDEF
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description