missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CXCL9 (Human) Recombinant Protein

Human CXCL9 full-length ORF ( AAH63122, 23 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004283-P01.25ug

Product Code. 16147831

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Specifications

Accession Number	AAH63122
Name	chemokine (C-X-C motif) ligand 9
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CXCL9
Protein Tag	GST

Gene ID (Entrez)	4283
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	CMK, Humig, MIG, SCYB9, crg-10
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description