missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CXCL9 (Human) Recombinant Protein
Human CXCL9 full-length ORF ( AAH63122, 23 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
344.00 € - 521.00 €
Specifications
| Accession Number | AAH63122 |
|---|---|
| Gene ID (Entrez) | 4283 |
| Name | chemokine (C-X-C motif) ligand 9 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16137831
|
Abnova™
H00004283-P01.10ug |
10 μg |
344.00 €
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16147831
|
Abnova™
H00004283-P01.25ug |
25 μg |
521.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
- Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Specifications
| AAH63122 | |
| chemokine (C-X-C motif) ligand 9 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| CMK, Humig, MIG, SCYB9, crg-10 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 4283 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CXCL9 | |
| GST |
Safety and Handling
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title