missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CXCL9 (Human) Recombinant Protein

Human CXCL9 full-length ORF ( AAH63122, 23 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

344.00 € - 521.00 €

Accession Number	AAH63122
Gene ID (Entrez)	4283
Name	chemokine (C-X-C motif) ligand 9
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16137831 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004283-P01.10ug	10 μg	344.00 € 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16147831 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004283-P01.25ug	25 μg	521.00 € 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Specifications

Accession Number	AAH63122
Name	chemokine (C-X-C motif) ligand 9
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	CMK, Humig, MIG, SCYB9, crg-10
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	4283
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CXCL9
Protein Tag	GST

Safety and Handling

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Description