missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Inorganic Pyrophosphatase/PPA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 515.00 €
Specifications
| Antigen | Inorganic Pyrophosphatase/PPA1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18497031
|
Novus Biologicals
NBP1-87788-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18203027
|
Bio-Techne
NBP1-87788 |
0.1 mL |
515.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Inorganic Pyrophosphatase/PPA1 Polyclonal specifically detects Inorganic Pyrophosphatase/PPA1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Inorganic Pyrophosphatase/PPA1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| diphosphate phosphohydrolase, EC 3.6.1.1, inorganic diphosphatase, inorganic pyrophosphatase, inorganic pyrophosphatase 1, IOPPPMGC111556, PP1, PPase, PPcytosolic inorganic pyrophosphatase, pyrophosphatase (inorganic), pyrophosphatase (inorganic) 1, pyrophosphatase 1, Pyrophosphate phospho-hydrolase, SID6-8061 | |
| PPA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| metabolism, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5464 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only