missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NHLH1 (Human) Recombinant Protein

Human NHLH1 full-length ORF ( AAH13789, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

335.00 € - 508.00 €

Accession Number	AAH13789
Gene ID (Entrez)	4807
Name	nescient helix loop helix 1
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16138381 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004807-P01.10ug	10 μg	335.00 € 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16148381 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004807-P01.25ug	25 μg	508.00 € 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Specifications

Accession Number	AAH13789
Name	nescient helix loop helix 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	HEN1, NSCL, NSCL1, bHLHa35
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	4807
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	NHLH1
Protein Tag	GST

Safety and Handling

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Description