Filtered Search Results
Search results for "TraceSELECT Inorganics"
Thermo Scientific™ Pyrophosphatase, inorganic (0.1 U/μL)
Catalyze the hydrolysis of inorganic pyrophosphate to two orthophosphates.
Naphthalene-2-sulfonic acid sodium salt, 98%, may cont. up to 10% residual inorganic salts and water, Thermo Scientific Chemicals
CAS: 532-02-5 Molecular Formula: C10H7NaO3S Molecular Weight (g/mol): 230.21 MDL Number: MFCD00064186 InChI Key: YWPOLRBWRRKLMW-UHFFFAOYSA-M Synonym: sodium 2-naphthalenesulfonate,sodium naphthalene-2-sulfonate,2-naphthalenesulfonic acid sodium salt,2-naphthalenesulfonic acid, sodium salt,unii-r5f0ctd2oj,sodium-2-naphthalenesulfonate,sodium naphthalene-6-sulfonate,2-naphthalene sulfonic acid sodium salt,sodium beta-naphthalenesulfonate,sodium naphthalene-2-sulphonate PubChem CID: 23661868 SMILES: [Na+].[O-]S(=O)(=O)C1=CC=C2C=CC=CC2=C1
PubChem CID | 23661868 |
---|---|
CAS | 532-02-5 |
Molecular Weight (g/mol) | 230.21 |
MDL Number | MFCD00064186 |
SMILES | [Na+].[O-]S(=O)(=O)C1=CC=C2C=CC=CC2=C1 |
Synonym | sodium 2-naphthalenesulfonate,sodium naphthalene-2-sulfonate,2-naphthalenesulfonic acid sodium salt,2-naphthalenesulfonic acid, sodium salt,unii-r5f0ctd2oj,sodium-2-naphthalenesulfonate,sodium naphthalene-6-sulfonate,2-naphthalene sulfonic acid sodium salt,sodium beta-naphthalenesulfonate,sodium naphthalene-2-sulphonate |
InChI Key | YWPOLRBWRRKLMW-UHFFFAOYSA-M |
Molecular Formula | C10H7NaO3S |
Sodium acetate, TraceSELECT™, Honeywell Fluka™
CAS: 127-09-3 Molecular Formula: C2H3NaO2 Molecular Weight (g/mol): 82.03 MDL Number: MFCD00012459 InChI Key: VMHLLURERBWHNL-UHFFFAOYSA-M Synonym: sodium acetate,acetic acid, sodium salt,sodium acetate anhydrous,sodium acetate, anhydrous,acetic acid sodium salt,anhydrous sodium acetate,sodii acetas,sodium ethanoate,natrium aceticum,octan sodny czech PubChem CID: 517045 ChEBI: CHEBI:32954 IUPAC Name: sodium;acetate SMILES: [Na+].CC([O-])=O
PubChem CID | 517045 |
---|---|
CAS | 127-09-3 |
Molecular Weight (g/mol) | 82.03 |
ChEBI | CHEBI:32954 |
MDL Number | MFCD00012459 |
SMILES | [Na+].CC([O-])=O |
Synonym | sodium acetate,acetic acid, sodium salt,sodium acetate anhydrous,sodium acetate, anhydrous,acetic acid sodium salt,anhydrous sodium acetate,sodii acetas,sodium ethanoate,natrium aceticum,octan sodny czech |
IUPAC Name | sodium;acetate |
InChI Key | VMHLLURERBWHNL-UHFFFAOYSA-M |
Molecular Formula | C2H3NaO2 |
Novus Biologicals™ Inorganic Pyrophosphatase/PPA1 Protein
Highly purified. Generating reliable and reproducible results.
Regulatory Status | RUO |
---|---|
Purification Method | SDS-PAGE |
Purity or Quality Grade | >95% |
Conjugate | Unconjugated |
Common Name | Inorganic Pyrophosphatase/PPA1 |
Molecular Weight (g/mol) | 21.9kDa |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 50mM NaCl |
Quantity | 0.5 mg |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
For Use With (Application) | SDS-PAGE |
Source | Bacteria |
Novus Biologicals™ Inorganic Pyrophosphatase/PPA1 Protein
Highly purified. Generating reliable and reproducible results.
Acetic Acid, TraceSELECT™, ≥99%, Honeywell Fluka™
CAS: 64-19-7 Molecular Formula: C2H4O2 Molecular Weight (g/mol): 60.05 MDL Number: MFCD00036152 InChI Key: QTBSBXVTEAMEQO-UHFFFAOYSA-N Synonym: ethanoic acid,ethylic acid,acetic acid, glacial,methanecarboxylic acid,vinegar acid,glacial,acetasol,acide acetique,essigsaeure PubChem CID: 176 ChEBI: CHEBI:15366 IUPAC Name: acetic acid SMILES: CC(O)=O
PubChem CID | 176 |
---|---|
CAS | 64-19-7 |
Molecular Weight (g/mol) | 60.05 |
ChEBI | CHEBI:15366 |
MDL Number | MFCD00036152 |
SMILES | CC(O)=O |
Synonym | ethanoic acid,ethylic acid,acetic acid, glacial,methanecarboxylic acid,vinegar acid,glacial,acetasol,acide acetique,essigsaeure |
IUPAC Name | acetic acid |
InChI Key | QTBSBXVTEAMEQO-UHFFFAOYSA-N |
Molecular Formula | C2H4O2 |
Water, TraceSELECT™, For Trace Analysis, Honeywell Riedel-de Haën™
CAS: 7732-18-5 Molecular Formula: H2O Molecular Weight (g/mol): 18.015 MDL Number: MFCD00011332 InChI Key: XLYOFNOQVPJJNP-UHFFFAOYSA-N Synonym: water,dihydrogen oxide,distilled water,purified water,water vapor,sterile water,water, purified,water, deionized,water, mineral,dihydrogen monoxide PubChem CID: 962 ChEBI: CHEBI:15377 IUPAC Name: oxidane SMILES: O
PubChem CID | 962 |
---|---|
CAS | 7732-18-5 |
Molecular Weight (g/mol) | 18.015 |
ChEBI | CHEBI:15377 |
MDL Number | MFCD00011332 |
SMILES | O |
Synonym | water,dihydrogen oxide,distilled water,purified water,water vapor,sterile water,water, purified,water, deionized,water, mineral,dihydrogen monoxide |
IUPAC Name | oxidane |
InChI Key | XLYOFNOQVPJJNP-UHFFFAOYSA-N |
Molecular Formula | H2O |
Nitric acid, TraceSELECT™, for trace analysis, ≥69.0%, Honeywell Fluka™
CAS: 7697-37-2 Molecular Formula: HNO3 Molecular Weight (g/mol): 63.01 MDL Number: MFCD00011349 InChI Key: GRYLNZFGIOXLOG-UHFFFAOYSA-N Synonym: hydrogen nitrate,aqua fortis,azotic acid,salpetersaeure,rfna,acidum nitricum,nital,acide nitrique,nitrous fumes,nitryl hydroxide PubChem CID: 944 ChEBI: CHEBI:48107 IUPAC Name: nitric acid SMILES: O[N+]([O-])=O
PubChem CID | 944 |
---|---|
CAS | 7697-37-2 |
Molecular Weight (g/mol) | 63.01 |
ChEBI | CHEBI:48107 |
MDL Number | MFCD00011349 |
SMILES | O[N+]([O-])=O |
Synonym | hydrogen nitrate,aqua fortis,azotic acid,salpetersaeure,rfna,acidum nitricum,nital,acide nitrique,nitrous fumes,nitryl hydroxide |
IUPAC Name | nitric acid |
InChI Key | GRYLNZFGIOXLOG-UHFFFAOYSA-N |
Molecular Formula | HNO3 |
Phosphoric acid, TraceSELECT™, Honeywell Fluka™
CAS: 7664-38-2 Molecular Formula: H3O4P Molecular Weight (g/mol): 97.994 MDL Number: MFCD00011340 InChI Key: NBIIXXVUZAFLBC-UHFFFAOYSA-N Synonym: orthophosphoric acid,sonac,o-phosphoric acid,phosphorsaeure,acidum phosphoricum,evits,wc-reiniger,acide phosphorique,white,acido fosforico PubChem CID: 1004 ChEBI: CHEBI:26078 IUPAC Name: phosphoric acid SMILES: OP(=O)(O)O
PubChem CID | 1004 |
---|---|
CAS | 7664-38-2 |
Molecular Weight (g/mol) | 97.994 |
ChEBI | CHEBI:26078 |
MDL Number | MFCD00011340 |
SMILES | OP(=O)(O)O |
Synonym | orthophosphoric acid,sonac,o-phosphoric acid,phosphorsaeure,acidum phosphoricum,evits,wc-reiniger,acide phosphorique,white,acido fosforico |
IUPAC Name | phosphoric acid |
InChI Key | NBIIXXVUZAFLBC-UHFFFAOYSA-N |
Molecular Formula | H3O4P |
Novus Biologicals™ Inorganic Pyrophosphatase/PPA1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | metabolism, Signal Transduction |
Antigen | Inorganic Pyrophosphatase/PPA1 |
Gene Symbols | PPA1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 |
Gene Alias | diphosphate phosphohydrolase, EC 3.6.1.1, inorganic diphosphatase, inorganic pyrophosphatase, inorganic pyrophosphatase 1, IOPPPMGC111556, PP1, PPase, PPcytosolic inorganic pyrophosphatase, pyrophosphatase (inorganic), pyrophosphatase (inorganic) 1, pyrophosphatase 1, Pyrophosphate phospho-hydrolase, SID6-8061 |
Gene ID (Entrez) | 5464 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |