1
–
15
of
208
results

Content And Storage | Store at 4&drg;C. Do not freeze. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Breast Cancer, Cancer |
Concentration | 0.2 mg/ml |
Antigen | TFF1/pS2 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gene Alias | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
Gene ID (Entrez) | 7031 |
Formulation | 10mM PBS with 0.05% BSA |
Immunogen | Recombinant fragment (around aa1-84) of human TFF1/pS2 protein (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | TFF1/7891 |
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Apoptosis |
Antigen | NCKAP1 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Gene ID (Entrez) | 10787 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Classification | Polyclonal |
Primary or Secondary | Primary |
R&D Systems™ H/M Pluripotent Stem Cell Multi-Color Flow Cytometry Kit
For single-step staining of human/mouse pluripotent stem cells (h/mPSCs) (1-7)
Content And Storage | Store at 4&drg;C. Do not freeze. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG1 κ |
Research Discipline | Cell Biology, Cellular Markers |
Concentration | 0.2 mg/ml |
Antigen | Cytokeratin 10 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gene Alias | BCIE, BIE, CK10, CK-10, cytokeratin 10, Cytokeratin-10, EHK, K10keratosis palmaris et plantaris, keratin 10, Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris), keratin, type I cytoskeletal 10, keratin-10, KPP |
Gene ID (Entrez) | 3858 |
Formulation | 10mM PBS with 0.05% BSA |
Immunogen | Recombinant fragment (around aa384-584) of human Cytokeratin 10 protein (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | rKRT10/6923 |
Novus Biologicals™ alpha Satellite Repeat Primer
alpha SAT primer for PCR in chromatin precipitation
Content And Storage | Store at –20°C. Avoid Free/Thaw Cycles |
---|---|
Product Type | alpha Satellite Repeat Primer |
For Use With (Application) | Chromatin Immunoprecipitation |
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 750, Novus Biologicals™
Rabbit Monoclonal Antibody
Content And Storage | Store at 4&drg;C. Do not freeze. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG κ |
Research Discipline | Cancer, Immunology, Innate Immunity |
Concentration | 0.2 mg/ml |
Antigen | STING/TMEM173 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gene Alias | endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173 |
Gene ID (Entrez) | 340061 |
Formulation | 10mM PBS with 0.05% BSA |
Immunogen | Recombinant fragment (around aa190-290) of human STING/TMEM173 protein (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | STING1/8187R |